Lineage for d2ehoh1 (2eho H:88-192)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1287113Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 1287114Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 1287133Family a.278.1.3: PSF3 C-terminal domain-like [158580] (1 protein)
    C-terminal part of Pfam PF06425
  6. 1287134Protein GINS complex subunit 3, PSF3 [158581] (1 species)
  7. 1287135Species Human (Homo sapiens) [TaxId:9606] [158582] (3 PDB entries)
    Uniprot Q9BRX5 88-92
  8. 1287141Domain d2ehoh1: 2eho H:88-192 [146854]
    Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehod2, d2ehoe1, d2ehof1, d2ehog1, d2ehog2, d2ehoh2, d2ehoi1, d2ehoj1, d2ehok1, d2ehok2, d2ehol2
    automatically matched to 2E9X C:1088-1192
    complexed with so4

Details for d2ehoh1

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (H:) GINS complex subunit 3

SCOPe Domain Sequences for d2ehoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehoh1 a.278.1.3 (H:88-192) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
lpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspenadisqsllqtfigrfr
rimdssqnaynedtsalvarldemerglfqtgqkglndfqcwekg

SCOPe Domain Coordinates for d2ehoh1:

Click to download the PDB-style file with coordinates for d2ehoh1.
(The format of our PDB-style files is described here.)

Timeline for d2ehoh1: