Class a: All alpha proteins [46456] (284 folds) |
Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) common to all subunits of the GINS complex |
Family a.278.1.3: PSF3 C-terminal domain-like [158580] (1 protein) C-terminal part of Pfam PF06425 |
Protein GINS complex subunit 3, PSF3 [158581] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158582] (3 PDB entries) Uniprot Q9BRX5 88-92 |
Domain d2ehoh1: 2eho H:88-192 [146854] Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehod2, d2ehoe1, d2ehof1, d2ehog1, d2ehog2, d2ehoh2, d2ehoi1, d2ehoj1, d2ehok1, d2ehok2, d2ehol2 automatically matched to 2E9X C:1088-1192 complexed with so4 |
PDB Entry: 2eho (more details), 3 Å
SCOPe Domain Sequences for d2ehoh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehoh1 a.278.1.3 (H:88-192) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} lpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspenadisqsllqtfigrfr rimdssqnaynedtsalvarldemerglfqtgqkglndfqcwekg
Timeline for d2ehoh1: