Class a: All alpha proteins [46456] (290 folds) |
Fold a.296: PMT central region-like [158841] (1 superfamily) multihelical; comprises two four-helical bundles of different topologies and an irregular helical array packed against a small beta-sheet |
Superfamily a.296.1: PMT central region-like [158842] (1 family) |
Family a.296.1.1: PMT central region-like [158843] (1 protein) |
Protein Dermonecrotic toxin, ToxA [158844] (1 species) Synonym: Mitogenic toxin PMT |
Species Pasteurella multocida [TaxId:747] [158845] (3 PDB entries) Uniprot P17452 575-874 |
Domain d2ebhx1: 2ebh X:575-874 [146769] Other proteins in same PDB: d2ebhx2, d2ebhx3 |
PDB Entry: 2ebh (more details), 2.4 Å
SCOPe Domain Sequences for d2ebhx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebhx1 a.296.1.1 (X:575-874) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]} lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes
Timeline for d2ebhx1: