SCOP 1.75: Domain d2ebhx1: 2ebh X:575-874

Lineage for d2ebhx1 (2ebh X:575-874)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.296: PMT central region-like [158841] (1 superfamily)
   multihelical; comprises two four-helical bundles of different topologies and an irregular helical array packed against a small beta-sheet

4. Superfamily a.296.1: PMT central region-like [158842] (1 family)

5. Family a.296.1.1: PMT central region-like [158843] (1 protein)

6. Protein Dermonecrotic toxin, ToxA [158844] (1 species)
   Synonym: Mitogenic toxin PMT

7. Species Pasteurella multocida [TaxId:747] [158845] (3 PDB entries)
   Uniprot P17452 575-874

8. Domain d2ebhx1: 2ebh X:575-874 [146769]
   Other proteins in same PDB: d2ebhx2, d2ebhx3
   complexed with tre; mutant

Details for d2ebhx1

PDB Entry: 2ebh, 2.4 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin

PDB Compounds: (X:) Dermonecrotic toxin

SCOP Domain Sequences for d2ebhx1:

Sequence; same for both SEQRES and ATOM records:

>d2ebhx1 a.296.1.1 (X:575-874) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes

Timeline for d2ebhx1:

• d2ebhx1 is new in SCOP 1.75
  
• d2ebhx1 appears in SCOPe 2.01
  
• d2ebhx1 appears in the current release, SCOPe 2.08