PDB entry 2ebh

View 2ebh on RCSB PDB site
Description: Crystal structures reveal a thiol-protease like catalytic triad in the C-terminal region of Pasteurella multocida toxin
Class: toxin
Keywords: Pasteurella multocida toxin, Cys1165Ser mutant, inactivated mutant
Deposited on 2007-02-08, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Dermonecrotic toxin
    Species: Pasteurella multocida [TaxId:747]
    Gene: toxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17452 (Start-745)
      • engineered (625)
    Domains in SCOPe 2.07: d2ebhx1, d2ebhx2, d2ebhx3
  • Heterogens: TRE, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2ebhX (X:)
    mghhhhhhdydipttenlyfqgahmgiqrvsnakllggspyspfriglegvwtpevlkar
    asvigkpigesykrilaklqrihnsnilderqglmhelmelidlyeesqpsserlnafre
    lrtqlekalylpemealkkqilqipnkgsgaarfllrtamnemagktsestadlirfalq
    dtvisapfrgyagaipeaidfpvkyviedisvfdkiqtnywelpayeswnegsnsallpg
    llresqskgmlskcriienslyighsyeemfysispysnqvggpyelypftffsmlqevq
    gdlgfeqafatrnffntlvsdrlslmentmlltesfdytpwdaiygdinydeqfaamsin
    eriekcmntyrgvafqnssksidfflnnlttfidnglteiaisdlpydivqqeisqflqg
    snewktldamlfnldkgdingafrkllqsakdnnikfraighsdnsvppfnnpykslyyk
    gniiaeaiekldregqkfvvfadssllnstpgtgrpmpglvqylkipatvvdsdgawqfl
    pdvassrvpievtelenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlre
    elmqkidaikndvkmnslvcmeagssdsvspkvaarlkdmgleagmgasitwwrreggme
    fshqmhttasfkfagkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfve
    yvsktgnmlalfmpplftkprltral
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebhX (X:)
    lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
    helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
    lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
    iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
    pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes
    fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
    glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
    kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
    pmpglvqylkipatvvdsdgawqflpdvassrvpievtelenwqvltppqgkilglkqfk
    ltagfpteqsrlpllensvsedlreelmqkidaikndvkmnslvcmeagssdsvspkvaa
    rlkdmgleagmgasitwwrreggmefshqmhttasfkfagkefavdashlqfvhdqldtt
    ililpvddwaleiaqrnrainpfveyvsktgnmlalfmpplftkprltral