SCOPe 2.04: Domain d2ea9a_: 2ea9 A:

Lineage for d2ea9a_ (2ea9 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.8: YeeU-like [143737] (1 family)
   beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
   automatically mapped to Pfam PF06154

5. Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
   Pfam PF06154

6. Protein Hypothetical protein YfjZ [143739] (1 species)

7. Species Escherichia coli [TaxId:562] [143740] (2 PDB entries)
   Uniprot P52141 1-105

8. Domain d2ea9a_: 2ea9 A: [146761]
   automated match to d2jn7a1

Details for d2ea9a_

PDB Entry: 2ea9, 2.1 Å

PDB Description: Crystal structure of a hypothetical protein JW2626 from E.coli

PDB Compounds: (A:) Hypothetical protein yfjZ

SCOPe Domain Sequences for d2ea9a_:

Sequence; same for both SEQRES and ATOM records:

>d2ea9a_ d.110.8.1 (A:) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]}
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavypt

Timeline for d2ea9a_:

• d2ea9a_ first appeared in SCOP 1.75, called d2ea9a1
  
• d2ea9a_ appears in SCOPe 2.03
  
• d2ea9a_ appears in SCOPe 2.05
  
• d2ea9a_ appears in the current release, SCOPe 2.08