SCOP 1.75: Domain d2ea9a1: 2ea9 A:8-110

Lineage for d2ea9a1 (2ea9 A:8-110)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.8: YeeU-like [143737] (1 family)
   beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer

5. Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
   Pfam PF06154

6. Protein Hypothetical protein YfjZ [143739] (1 species)

7. Species Escherichia coli [TaxId:562] [143740] (2 PDB entries)
   Uniprot P52141 1-105

8. Domain d2ea9a1: 2ea9 A:8-110 [146761]
   automatically matched to d2jn7a1

Details for d2ea9a1

PDB Entry: 2ea9, 2.1 Å

PDB Description: Crystal structure of a hypothetical protein JW2626 from E.coli

PDB Compounds: (A:) Hypothetical protein yfjZ

SCOP Domain Sequences for d2ea9a1:

Sequence; same for both SEQRES and ATOM records:

>d2ea9a1 d.110.8.1 (A:8-110) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]}
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavypt

Timeline for d2ea9a1:

• d2ea9a1 is new in SCOP 1.75
  
• d2ea9a1 is called d2ea9a_ in SCOPe 2.01
  
• d2ea9a1 appears in the current release, SCOPe 2.08, called d2ea9a_