Lineage for d2ea9a_ (2ea9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971168Superfamily d.110.8: YeeU-like [143737] (1 family) (S)
    beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
    automatically mapped to Pfam PF06154
  5. 2971169Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
    Pfam PF06154
  6. 2971177Protein Hypothetical protein YfjZ [143739] (1 species)
  7. 2971178Species Escherichia coli [TaxId:562] [143740] (2 PDB entries)
    Uniprot P52141 1-105
  8. 2971179Domain d2ea9a_: 2ea9 A: [146761]
    automated match to d2jn7a1

Details for d2ea9a_

PDB Entry: 2ea9 (more details), 2.1 Å

PDB Description: Crystal structure of a hypothetical protein JW2626 from E.coli
PDB Compounds: (A:) Hypothetical protein yfjZ

SCOPe Domain Sequences for d2ea9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ea9a_ d.110.8.1 (A:) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]}
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavypt

SCOPe Domain Coordinates for d2ea9a_:

Click to download the PDB-style file with coordinates for d2ea9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ea9a_: