Lineage for d2ea0a3 (2ea0 A:223-262)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587144Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 2587187Protein Endonuclease VIII [82917] (1 species)
  7. 2587188Species Escherichia coli [TaxId:562] [82918] (8 PDB entries)
    Uniprot P50465
  8. 2587190Domain d2ea0a3: 2ea0 A:223-262 [146756]
    Other proteins in same PDB: d2ea0a1, d2ea0a2
    automated match to d1k3wa3
    protein/DNA complex; complexed with gol, so4, zn

Details for d2ea0a3

PDB Entry: 2ea0 (more details), 1.4 Å

PDB Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli in complex with AP-site containing DNA substrate
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d2ea0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ea0a3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]}
alfrfkvfhrdgepcercgsiiekttlssrpfywcpgcqh

SCOPe Domain Coordinates for d2ea0a3:

Click to download the PDB-style file with coordinates for d2ea0a3.
(The format of our PDB-style files is described here.)

Timeline for d2ea0a3: