Lineage for d2ea0a1 (2ea0 A:125-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735377Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 2735420Protein Endonuclease VIII [81703] (1 species)
  7. 2735421Species Escherichia coli [TaxId:562] [81704] (8 PDB entries)
    Uniprot P50465
  8. 2735423Domain d2ea0a1: 2ea0 A:125-214 [146754]
    Other proteins in same PDB: d2ea0a2, d2ea0a3
    automated match to d1k3wa1
    protein/DNA complex; complexed with gol, so4, zn

Details for d2ea0a1

PDB Entry: 2ea0 (more details), 1.4 Å

PDB Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli in complex with AP-site containing DNA substrate
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d2ea0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ea0a1 a.156.1.2 (A:125-214) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrgq

SCOPe Domain Coordinates for d2ea0a1:

Click to download the PDB-style file with coordinates for d2ea0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ea0a1: