Class b: All beta proteins [48724] (180 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) automatically mapped to Pfam PF01149 |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
Protein Endonuclease VIII [82233] (1 species) |
Species Escherichia coli [TaxId:562] [82234] (8 PDB entries) Uniprot P50465 |
Domain d2ea0a2: 2ea0 A:1-124 [146755] Other proteins in same PDB: d2ea0a1, d2ea0a3 automated match to d1k3wa2 protein/DNA complex; complexed with gol, so4, zn |
PDB Entry: 2ea0 (more details), 1.4 Å
SCOPe Domain Sequences for d2ea0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ea0a2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]} pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp flqr
Timeline for d2ea0a2: