Lineage for d2ea0a2 (2ea0 A:1-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821188Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2821189Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2821190Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2821233Protein Endonuclease VIII [82233] (1 species)
  7. 2821234Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
    Uniprot P50465
  8. 2821236Domain d2ea0a2: 2ea0 A:1-124 [146755]
    Other proteins in same PDB: d2ea0a1, d2ea0a3
    automated match to d1k3wa2
    protein/DNA complex; complexed with gol, so4, zn

Details for d2ea0a2

PDB Entry: 2ea0 (more details), 1.4 Å

PDB Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli in complex with AP-site containing DNA substrate
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d2ea0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ea0a2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

SCOPe Domain Coordinates for d2ea0a2:

Click to download the PDB-style file with coordinates for d2ea0a2.
(The format of our PDB-style files is described here.)

Timeline for d2ea0a2: