Lineage for d1k3wa2 (1k3w A:1-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821188Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2821189Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2821190Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2821233Protein Endonuclease VIII [82233] (1 species)
  7. 2821234Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
    Uniprot P50465
  8. 2821237Domain d1k3wa2: 1k3w A:1-124 [77240]
    Other proteins in same PDB: d1k3wa1, d1k3wa3
    protein/DNA complex; complexed with so4, zn

Details for d1k3wa2

PDB Entry: 1k3w (more details), 1.42 Å

PDB Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1k3wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3wa2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

SCOPe Domain Coordinates for d1k3wa2:

Click to download the PDB-style file with coordinates for d1k3wa2.
(The format of our PDB-style files is described here.)

Timeline for d1k3wa2: