| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
| Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (2 PDB entries) Uniprot Q5SI76 371-447! Uniprot Q5SI76 563-658 TTHA1498 |
| Domain d2dy1a5: 2dy1 A:570-665 [146611] Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a3 automatically matched to d1wdta4 complexed with gtp, mg |
PDB Entry: 2dy1 (more details), 1.6 Å
SCOP Domain Sequences for d2dy1a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]}
vllepiyrlkvlapqervgdvlsdlqarrgrilgmeqegalsvvhaevplaevleyykal
pgltggagaytlefshyaevpphlaqrivqeraqeg
Timeline for d2dy1a5:
View in 3DDomains from same chain: (mouse over for more information) d2dy1a1, d2dy1a2, d2dy1a3, d2dy1a4 |