Lineage for d2dy1a3 (2dy1 A:455-569)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853012Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 853024Species Thermus thermophilus, EF-G-2 [TaxId:274] [142925] (2 PDB entries)
    Uniprot Q5SI76 448-562
    TTHA1498
  8. 853025Domain d2dy1a3: 2dy1 A:455-569 [146609]
    Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a4, d2dy1a5
    automatically matched to d1wdta3
    complexed with gtp, mg

Details for d2dy1a3

PDB Entry: 2dy1 (more details), 1.6 Å

PDB Description: Crystal structure of EF-G-2 from Thermus thermophilus
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d2dy1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]}
pyretikkvaegqgkykkqtgghgqygdvwlrlepaseygfewritggvipskyqeaiee
gikeaakkgvlagfpvmgfkaivyngsyhevdssdlafqiaaslafkkvmaeahp

SCOP Domain Coordinates for d2dy1a3:

Click to download the PDB-style file with coordinates for d2dy1a3.
(The format of our PDB-style files is described here.)

Timeline for d2dy1a3: