Lineage for d2dy1a4 (2dy1 A:378-454)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862792Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 862793Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 862842Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 862858Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (2 PDB entries)
    Uniprot Q5SI76 371-447! Uniprot Q5SI76 563-658
    TTHA1498
  8. 862859Domain d2dy1a4: 2dy1 A:378-454 [146610]
    Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a3
    automatically matched to d1wdta5
    complexed with gtp, mg

Details for d2dy1a4

PDB Entry: 2dy1 (more details), 1.6 Å

PDB Description: Crystal structure of EF-G-2 from Thermus thermophilus
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d2dy1a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]}
lpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelllwghgelhlatak
erlqdygvevefsvpkv

SCOP Domain Coordinates for d2dy1a4:

Click to download the PDB-style file with coordinates for d2dy1a4.
(The format of our PDB-style files is described here.)

Timeline for d2dy1a4: