PDB entry 2dy1

View 2dy1 on RCSB PDB site
Description: Crystal structure of EF-G-2 from Thermus thermophilus
Class: signaling protein, translation
Keywords: Translocation, ELONGATION, GTP Complex, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN, TRANSLATION
Deposited on 2006-09-04, released 2007-09-25
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-25, with a file datestamp of 2007-09-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SI76 (7-664)
      • expression tag (5-6)
    Domains in SCOP 1.75: d2dy1a1, d2dy1a2, d2dy1a3, d2dy1a4, d2dy1a5
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dy1A (A:)
    mgteggamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrt
    tvrtgvapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawt
    vaerlglprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgka
    yryengeereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafhe
    avrrgllypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqv
    aylrlyrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgm
    vlwqgekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeet
    gelllwghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqy
    gdvwlrlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyng
    syhevdssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgr
    ilgmeqegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqe
    raqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dy1A (A:)
    gamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtg
    vapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerl
    glprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryen
    geereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrg
    llypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqvaylrl
    yrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgmvlwqg
    ekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelll
    wghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqygdvwl
    rlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyngsyhev
    dssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgrilgme
    qegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqeraqeg