![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
![]() | Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
![]() | Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries) |
![]() | Domain d2ducb_: 2duc B: [146587] automated match to d1uj1b_ has additional subdomain(s) that are not in the common domain |
PDB Entry: 2duc (more details), 1.7 Å
SCOPe Domain Sequences for d2ducb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ducb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc sgvtfq
Timeline for d2ducb_: