Lineage for d2degb_ (2deg B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613923Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 2613924Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 2613934Protein automated matches [190247] (4 species)
    not a true protein
  7. 2614006Species Thermus thermophilus [TaxId:274] [187616] (3 PDB entries)
  8. 2614008Domain d2degb_: 2deg B: [146493]
    automated match to d2cz8a1
    complexed with gol, mn, na

Details for d2degb_

PDB Entry: 2deg (more details), 1.7 Å

PDB Description: Crystal structure of tt0972 protein form Thermus Thermophilus with Mn2(+) ions
PDB Compounds: (B:) tt0972 protein

SCOPe Domain Sequences for d2degb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2degb_ d.230.2.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrleet

SCOPe Domain Coordinates for d2degb_:

Click to download the PDB-style file with coordinates for d2degb_.
(The format of our PDB-style files is described here.)

Timeline for d2degb_: