Lineage for d2cz8a1 (2cz8 A:2-68)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613923Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 2613924Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 2613929Protein Uncharacterized protein TTHA1431 [159869] (1 species)
  7. 2613930Species Thermus thermophilus [TaxId:274] [159870] (3 PDB entries)
    Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68
  8. 2613932Domain d2cz8a1: 2cz8 A:2-68 [146432]
    Other proteins in same PDB: d2cz8b_, d2cz8c_, d2cz8d_, d2cz8e_, d2cz8f_, d2cz8g_, d2cz8h_
    complexed with fad, k, po4

Details for d2cz8a1

PDB Entry: 2cz8 (more details), 1.5 Å

PDB Description: Crystal Structure of tt0972 protein from Thermus thermophilus
PDB Compounds: (A:) tt0972 protein

SCOPe Domain Sequences for d2cz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz8a1 d.230.2.1 (A:2-68) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrlee

SCOPe Domain Coordinates for d2cz8a1:

Click to download the PDB-style file with coordinates for d2cz8a1.
(The format of our PDB-style files is described here.)

Timeline for d2cz8a1: