Lineage for d2d28c1 (2d28 C:1-149)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648684Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1648935Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family) (S)
    contains extra C-terminal helix that packs against shorter N-terminal helix
  5. 1648936Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
    Pfam PF05157 (also includes PfamB PB000210)
  6. 1648940Protein Type II secretion ATPase XpsE [160248] (1 species)
    contains extra N-terminal alpha-helical subdomain, that can form swapped dimers
  7. 1648941Species Xanthomonas campestris [TaxId:339] [160249] (2 PDB entries)
    Uniprot P31742 1-148! Uniprot P31742 1-149
  8. 1648942Domain d2d28c1: 2d28 C:1-149 [146450]
    complexed with cac

Details for d2d28c1

PDB Entry: 2d28 (more details), 2 Å

PDB Description: structure of the n-terminal domain of xpse (crystal form p43212)
PDB Compounds: (C:) type II secretion ATPase XpsE

SCOPe Domain Sequences for d2d28c1:

Sequence, based on SEQRES records: (download)

>d2d28c1 d.52.10.1 (C:1-149) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}
meqrsaetriveallerrrlkdtdlvrarqlqaesgmgllallgrlglvserdhaetcae
vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
avrlatglplllhvglrseiddlierwyg

Sequence, based on observed residues (ATOM records): (download)

>d2d28c1 d.52.10.1 (C:1-149) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}
meqrsaetriveallerrrlkdtdlvrarqesgmgllallgrlglvserdhaetcaevlg
lplvdarqlgdtppemevqglslrflkqfhlcpvgerdgrldlwiadpyddyaidavrla
tglplllhvglrseiddlierwyg

SCOPe Domain Coordinates for d2d28c1:

Click to download the PDB-style file with coordinates for d2d28c1.
(The format of our PDB-style files is described here.)

Timeline for d2d28c1: