SCOPe 2.08: Domain d2d28c1: 2d28 C:1-149

Lineage for d2d28c1 (2d28 C:1-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family)
   contains extra C-terminal helix that packs against shorter N-terminal helix

5. Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
   Pfam PF05157 (also includes PfamB PB000210)

6. Protein Type II secretion ATPase XpsE [160248] (1 species)
   contains extra N-terminal alpha-helical subdomain, that can form swapped dimers

7. Species Xanthomonas campestris [TaxId:339] [160249] (2 PDB entries)
   Uniprot P31742 1-148! Uniprot P31742 1-149

8. Domain d2d28c1: 2d28 C:1-149 [146450]
   complexed with cac
   has additional subdomain(s) that are not in the common domain

Details for d2d28c1

PDB Entry: 2d28, 2 Å

PDB Description: structure of the n-terminal domain of xpse (crystal form p43212)

PDB Compounds: (C:) type II secretion ATPase XpsE

SCOPe Domain Sequences for d2d28c1:

Sequence, based on SEQRES records:

>d2d28c1 d.52.10.1 (C:1-149) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}
meqrsaetriveallerrrlkdtdlvrarqlqaesgmgllallgrlglvserdhaetcae
vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
avrlatglplllhvglrseiddlierwyg

Sequence, based on observed residues (ATOM records):

>d2d28c1 d.52.10.1 (C:1-149) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}
meqrsaetriveallerrrlkdtdlvrarqesgmgllallgrlglvserdhaetcaevlg
lplvdarqlgdtppemevqglslrflkqfhlcpvgerdgrldlwiadpyddyaidavrla
tglplllhvglrseiddlierwyg

Timeline for d2d28c1:

• d2d28c1 first appeared in SCOP 1.75
  
• d2d28c1 appears in SCOPe 2.07