PDB entry 2d28

View 2d28 on RCSB PDB site
Description: Structure of the N-terminal domain of XpsE (crystal form P43212)
Class: protein transport
Keywords: alpha-beta sandwich, PROTEIN TRANSPORT
Deposited on 2005-09-03, released 2005-09-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: type II secretion ATPase XpsE
    Species: Xanthomonas campestris [TaxId:339]
    Gene: xpsE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31742 (0-148)
      • modified residue (0)
      • engineered (25)
      • modified residue (36)
      • modified residue (78)
    Domains in SCOPe 2.04: d2d28c1
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d28C (C:)
    meqrsaetriveallerrrlkdtdlvrarqlqaesgmgllallgrlglvserdhaetcae
    vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
    avrlatglplllhvglrseiddlierwyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d28C (C:)
    meqrsaetriveallerrrlkdtdlvrarqesgmgllallgrlglvserdhaetcaevlg
    lplvdarqlgdtppemevqglslrflkqfhlcpvgerdgrldlwiadpyddyaidavrla
    tglplllhvglrseiddlierwyg