Lineage for d2br2p1 (2br2 P:1-155)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930318Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2930319Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 2930327Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 2930339Domain d2br2p1: 2br2 P:1-155 [146195]
    Other proteins in same PDB: d2br2a1, d2br2a2, d2br2b2, d2br2c1, d2br2c2, d2br2d2, d2br2e1, d2br2e2, d2br2f2, d2br2g1, d2br2g2, d2br2h2, d2br2i1, d2br2i2, d2br2j2, d2br2k1, d2br2k2, d2br2l2, d2br2m1, d2br2m2, d2br2n2, d2br2o1, d2br2o2, d2br2p2, d2br2q1, d2br2q2, d2br2r2, d2br2s1, d2br2s2, d2br2t2, d2br2u1, d2br2u2, d2br2v2, d2br2w1, d2br2w2, d2br2x2
    automated match to d2br2b1
    complexed with cl

Details for d2br2p1

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (P:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2br2p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br2p1 d.14.1.4 (P:1-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
prtaidvfteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2br2p1:

Click to download the PDB-style file with coordinates for d2br2p1.
(The format of our PDB-style files is described here.)

Timeline for d2br2p1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2p2
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2s1, d2br2s2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2