SCOPe 2.08: Domain d2br2a2: 2br2 A:192-275

Lineage for d2br2a2 (2br2 A:192-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)

8. Domain d2br2a2: 2br2 A:192-275 [146166]
   Other proteins in same PDB: d2br2a1, d2br2b1, d2br2b2, d2br2c1, d2br2d1, d2br2d2, d2br2e1, d2br2f1, d2br2f2, d2br2g1, d2br2h1, d2br2h2, d2br2i1, d2br2j1, d2br2j2, d2br2k1, d2br2l1, d2br2l2, d2br2m1, d2br2n1, d2br2n2, d2br2o1, d2br2p1, d2br2p2, d2br2q1, d2br2r1, d2br2r2, d2br2s1, d2br2t1, d2br2t2, d2br2u1, d2br2v1, d2br2v2, d2br2w1, d2br2x1, d2br2x2
   automated match to d2je6a2
   complexed with cl

Details for d2br2a2

PDB Entry: 2br2, 2.8 Å

PDB Description: rnase ph core of the archaeal exosome

PDB Compounds: (A:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2br2a2:

Sequence; same for both SEQRES and ATOM records:

>d2br2a2 d.101.1.0 (A:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

Timeline for d2br2a2:

• d2br2a2 first appeared in SCOP 1.75
  
• d2br2a2 appears in SCOPe 2.07