Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein Invasin AfaD [158928] (1 species) |
Species Escherichia coli [TaxId:562] [158929] (3 PDB entries) Uniprot Q47038 27-147 |
Domain d2axwb_: 2axw B: [146076] automated match to d2axwa1 complexed with cl, gol |
PDB Entry: 2axw (more details), 1.05 Å
SCOPe Domain Sequences for d2axwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axwb_ b.2.3.2 (B:) Invasin AfaD {Escherichia coli [TaxId: 562]} aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq eklaaalehhhhhh
Timeline for d2axwb_: