SCOPe 2.08: Domain d2axwb2: 2axw B:1-121

Lineage for d2axwb2 (2axw B:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Invasin AfaD [158928] (1 species)

7. Species Escherichia coli [TaxId:562] [158929] (3 PDB entries)
   Uniprot Q47038 27-147

8. Domain d2axwb2: 2axw B:1-121 [146076]
   Other proteins in same PDB: d2axwa2, d2axwb3
   automated match to d2axwa1
   complexed with cl, gol

Details for d2axwb2

PDB Entry: 2axw, 1.05 Å

PDB Description: Structure of DraD invasin from uropathogenic Escherichia coli

PDB Compounds: (B:) DraD invasin

SCOPe Domain Sequences for d2axwb2:

Sequence; same for both SEQRES and ATOM records:

>d2axwb2 b.2.3.2 (B:1-121) Invasin AfaD {Escherichia coli [TaxId: 562]}
aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
e

Timeline for d2axwb2:

• d2axwb2 first appeared in SCOP 1.75, called d2axwb1
  
• d2axwb2 appears in SCOPe 2.07