![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (6 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (8 proteins) |
![]() | Protein Invasin AfaD [158928] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [158929] (3 PDB entries) Uniprot Q47038 27-147 |
![]() | Domain d2axwb1: 2axw B:1-121 [146076] automatically matched to 2AXW A:1-121 complexed with cl, gol |
PDB Entry: 2axw (more details), 1.05 Å
SCOP Domain Sequences for d2axwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axwb1 b.2.3.2 (B:1-121) Invasin AfaD {Escherichia coli [TaxId: 562]} aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq e
Timeline for d2axwb1: