| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein Telomere repeat-binding protein [158246] (1 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [158247] (1 PDB entry) Uniprot Q9LTI6 464-560 |
| Domain d2ajea1: 2aje A:9-105 [146056] |
PDB Entry: 2aje (more details)
SCOPe Domain Sequences for d2ajea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajea1 a.4.1.3 (A:9-105) Telomere repeat-binding protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qrrirrpfsvaevealvqaveklgtgrwrdvklcafedadhrtyvdlkdkwktlvhtaki
spqqrrgepvpqellnrvlnahgywtqqqmqqlqqnv
Timeline for d2ajea1: