Lineage for d2ajea1 (2aje A:9-105)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692125Protein Telomere repeat-binding protein [158246] (1 species)
  7. 2692126Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [158247] (1 PDB entry)
    Uniprot Q9LTI6 464-560
  8. 2692127Domain d2ajea1: 2aje A:9-105 [146056]

Details for d2ajea1

PDB Entry: 2aje (more details)

PDB Description: solution structure of the arabidopsis thaliana telomeric repeat- binding protein dna binding domain
PDB Compounds: (A:) telomere repeat-binding protein

SCOPe Domain Sequences for d2ajea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajea1 a.4.1.3 (A:9-105) Telomere repeat-binding protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qrrirrpfsvaevealvqaveklgtgrwrdvklcafedadhrtyvdlkdkwktlvhtaki
spqqrrgepvpqellnrvlnahgywtqqqmqqlqqnv

SCOPe Domain Coordinates for d2ajea1:

Click to download the PDB-style file with coordinates for d2ajea1.
(The format of our PDB-style files is described here.)

Timeline for d2ajea1: