PDB entry 2aje

View 2aje on RCSB PDB site
Description: Solution structure of the Arabidopsis thaliana telomeric repeat-binding protein DNA binding domain
Class: DNA binding protein
Keywords: telomere, DNA-binding, TRP, Myb motif, DNA BINDING PROTEIN
Deposited on 2005-08-01, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomere repeat-binding protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ajea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ajeA (A:)
gshmledpqrrirrpfsvaevealvqaveklgtgrwrdvklcafedadhrtyvdlkdkwk
tlvhtakispqqrrgepvpqellnrvlnahgywtqqqmqqlqqnv

    Sequence, based on observed residues (ATOM records): (download) 
    >2ajeA (A:)
qrrirrpfsvaevealvqaveklgtgrwrdvklcafedadhrtyvdlkdkwktlvhtaki
spqqrrgepvpqellnrvlnahgywtqqqmqqlqqnv