SCOPe 2.07: Domain d1zvfa1: 1zvf A:1-175

Lineage for d1zvfa1 (1zvf A:1-175)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
   Pfam PF06052; 3-HAO

6. Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159292] (1 PDB entry)
   Uniprot P47096 1-175

8. Domain d1zvfa1: 1zvf A:1-175 [146029]
   Other proteins in same PDB: d1zvfa2, d1zvfb2, d1zvfb3
   complexed with ni

Details for d1zvfa1

PDB Entry: 1zvf, 2.41 Å

PDB Description: the crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from saccharomyces cerevisiae

PDB Compounds: (A:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d1zvfa1:

Sequence; same for both SEQRES and ATOM records:

>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyqk
kgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggend
kirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlnyarpq

Timeline for d1zvfa1:

• d1zvfa1 first appeared in SCOP 1.75
  
• d1zvfa1 appears in SCOPe 2.06
  
• d1zvfa1 appears in the current release, SCOPe 2.08