Lineage for d1zvfa1 (1zvf A:1-175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815116Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
    Pfam PF06052; 3-HAO
  6. 2815117Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)
  7. 2815118Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159292] (1 PDB entry)
    Uniprot P47096 1-175
  8. 2815119Domain d1zvfa1: 1zvf A:1-175 [146029]
    Other proteins in same PDB: d1zvfa2, d1zvfb2, d1zvfb3
    complexed with ni

Details for d1zvfa1

PDB Entry: 1zvf (more details), 2.41 Å

PDB Description: the crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from saccharomyces cerevisiae
PDB Compounds: (A:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d1zvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyqk
kgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggend
kirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlnyarpq

SCOPe Domain Coordinates for d1zvfa1:

Click to download the PDB-style file with coordinates for d1zvfa1.
(The format of our PDB-style files is described here.)

Timeline for d1zvfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zvfa2