Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (24 families) |
Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (1 protein) Pfam PF06052; 3-HAO |
Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159292] (1 PDB entry) Uniprot P47096 1-175 |
Domain d1zvfa1: 1zvf A:1-175 [146029] complexed with ni |
PDB Entry: 1zvf (more details), 2.41 Å
SCOP Domain Sequences for d1zvfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyqk kgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggend kirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlnyarpq
Timeline for d1zvfa1: