SCOPe 2.05: Domain d1zela1: 1zel A:1-82

Lineage for d1zela1 (1zel A:1-82)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.83: Rv2827c N-terminal domain-like [158335] (1 protein)
   ~80 N-terminal residues of Pfam PF09407' DUF2005

6. Protein Hypothetical protein Rv2827c [158336] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [158337] (1 PDB entry)
   Uniprot P71625 1-82

8. Domain d1zela1: 1zel A:1-82 [145994]
   Other proteins in same PDB: d1zela2, d1zelb2
   complexed with act, fmt, mpd, na

Details for d1zela1

PDB Entry: 1zel, 1.93 Å

PDB Description: crystal structure of rv2827c protein from mycobacterium tuberculosis

PDB Compounds: (A:) hypothetical protein Rv2827c

SCOPe Domain Sequences for d1zela1:

Sequence; same for both SEQRES and ATOM records:

>d1zela1 a.4.5.83 (A:1-82) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]}
vvspagadrriptwasrvvsglardrpvvvtkedltqrlteagcgrdpdsairelrrigw
lvqlpvkgtwafippgeaaisd

Timeline for d1zela1:

• d1zela1 first appeared in SCOP 1.75
  
• d1zela1 appears in SCOPe 2.04
  
• d1zela1 appears in SCOPe 2.06
  
• d1zela1 appears in the current release, SCOPe 2.08