Lineage for d1zela2 (1zel A:83-294)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948759Fold d.377: Rv2827c C-terminal domain-like [160886] (1 superfamily)
    multihelical array flanked by two three-stranded mixed beta-sheets
  4. 1948760Superfamily d.377.1: Rv2827c C-terminal domain-like [160887] (1 family) (S)
  5. 1948761Family d.377.1.1: Rv2827c C-terminal domain-like [160888] (1 protein)
    the C-terminal part (~210 residues) of Pfam PF09407; DUF2005
  6. 1948762Protein Hypothetical protein Rv2827c [160889] (1 species)
  7. 1948763Species Mycobacterium tuberculosis [TaxId:1773] [160890] (1 PDB entry)
    Uniprot P71625 83-294
  8. 1948764Domain d1zela2: 1zel A:83-294 [145995]
    Other proteins in same PDB: d1zela1, d1zelb1
    complexed with act, fmt, mpd, na

Details for d1zela2

PDB Entry: 1zel (more details), 1.93 Å

PDB Description: crystal structure of rv2827c protein from mycobacterium tuberculosis
PDB Compounds: (A:) hypothetical protein Rv2827c

SCOPe Domain Sequences for d1zela2:

Sequence, based on SEQRES records: (download)

>d1zela2 d.377.1.1 (A:83-294) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]}
pylplrswlardqnagfmlagasaawhlgyldrqpdgripiwlppakrlpdglasyvsvv
ripwnaadtallaprpallvrrrldlvawatglpalgpeallvqiatrpasfgpwadlvp
hlddlvadcsderlerllsgrptsawqrasylldsggepargqallakrhtevmpvtrft
tahsrdrgesvwapeyqlvdelvvpllrvigk

Sequence, based on observed residues (ATOM records): (download)

>d1zela2 d.377.1.1 (A:83-294) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]}
pylplrswlardqnagfmlagasaawhlgyldrqpdgripiwlppakrlpdglasyvsvv
ripwnaadtallaprpallvrrrldlvawatglpalgpeallvqiatrpasfgpwadlvp
hlddlvadcsderlerllsgrptsawqrasylldsggepargqallakrhtevmpvtrft
tahsgesvwapeyqlvdelvvpllrvigk

SCOPe Domain Coordinates for d1zela2:

Click to download the PDB-style file with coordinates for d1zela2.
(The format of our PDB-style files is described here.)

Timeline for d1zela2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zela1