Lineage for d1zela1 (1zel A:1-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694517Family a.4.5.83: Rv2827c N-terminal domain-like [158335] (1 protein)
    ~80 N-terminal residues of Pfam PF09407' DUF2005
  6. 2694518Protein Hypothetical protein Rv2827c [158336] (1 species)
  7. 2694519Species Mycobacterium tuberculosis [TaxId:1773] [158337] (1 PDB entry)
    Uniprot P71625 1-82
  8. 2694520Domain d1zela1: 1zel A:1-82 [145994]
    Other proteins in same PDB: d1zela2, d1zela3, d1zelb2, d1zelb3
    complexed with act, fmt, mpd, na

Details for d1zela1

PDB Entry: 1zel (more details), 1.93 Å

PDB Description: crystal structure of rv2827c protein from mycobacterium tuberculosis
PDB Compounds: (A:) hypothetical protein Rv2827c

SCOPe Domain Sequences for d1zela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zela1 a.4.5.83 (A:1-82) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]}
vvspagadrriptwasrvvsglardrpvvvtkedltqrlteagcgrdpdsairelrrigw
lvqlpvkgtwafippgeaaisd

SCOPe Domain Coordinates for d1zela1:

Click to download the PDB-style file with coordinates for d1zela1.
(The format of our PDB-style files is described here.)

Timeline for d1zela1: