![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.83: Rv2827c N-terminal domain-like [158335] (1 protein) ~80 N-terminal residues of Pfam PF09407' DUF2005 |
![]() | Protein Hypothetical protein Rv2827c [158336] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [158337] (1 PDB entry) Uniprot P71625 1-82 |
![]() | Domain d1zela1: 1zel A:1-82 [145994] Other proteins in same PDB: d1zela2, d1zela3, d1zelb2, d1zelb3 complexed with act, fmt, mpd, na |
PDB Entry: 1zel (more details), 1.93 Å
SCOPe Domain Sequences for d1zela1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zela1 a.4.5.83 (A:1-82) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]} vvspagadrriptwasrvvsglardrpvvvtkedltqrlteagcgrdpdsairelrrigw lvqlpvkgtwafippgeaaisd
Timeline for d1zela1: