Lineage for d1ywho2 (1ywh O:1-81)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063196Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species)
    duplication; comprises three domains of this fold
  7. 1063197Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries)
    Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104
  8. 1063226Domain d1ywho2: 1ywh O:1-81 [145947]
    automatically matched to 1YWH A:1-82
    complexed with nag, ndg, so4

Details for d1ywho2

PDB Entry: 1ywh (more details), 2.7 Å

PDB Description: crystal structure of urokinase plasminogen activator receptor
PDB Compounds: (O:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d1ywho2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywho2 g.7.1.3 (O:1-81) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnqgns

SCOPe Domain Coordinates for d1ywho2:

Click to download the PDB-style file with coordinates for d1ywho2.
(The format of our PDB-style files is described here.)

Timeline for d1ywho2: