| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species) duplication; comprises three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries) Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104 |
| Domain d1ywhk1: 1ywh K:90-188 [145940] automatically matched to 1YWH A:89-188 complexed with nag, ndg, so4 |
PDB Entry: 1ywh (more details), 2.7 Å
SCOPe Domain Sequences for d1ywhk1:
Sequence, based on SEQRES records: (download)
>d1ywhk1 g.7.1.3 (K:90-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
sryleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgy
lpgcpgsngfhnndtfhflkccnttkcnegpilelenlp
>d1ywhk1 g.7.1.3 (K:90-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
sryleciscgssdmscergrhqslqcrspeeqcldvvthwikddrhlrgcgylpgcpgsn
gfhnndtfhflkccnttkcnegpilelenlp
Timeline for d1ywhk1: