Lineage for d1ywhi3 (1ywh I:189-275)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637186Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 2637187Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 2637208Domain d1ywhi3: 1ywh I:189-275 [145939]
    automated match to d1ywha3
    complexed with nag, ndg, so4

Details for d1ywhi3

PDB Entry: 1ywh (more details), 2.7 Å

PDB Description: crystal structure of urokinase plasminogen activator receptor
PDB Compounds: (I:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d1ywhi3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywhi3 g.7.1.3 (I:189-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgqsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
hahlgdafsmnhidvscctksgcnhpd

SCOPe Domain Coordinates for d1ywhi3:

Click to download the PDB-style file with coordinates for d1ywhi3.
(The format of our PDB-style files is described here.)

Timeline for d1ywhi3: