|  | Class g: Small proteins [56992] (98 folds) | 
|  | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta | 
|  | Superfamily g.7.1: Snake toxin-like [57302] (4 families)  | 
|  | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) | 
|  | Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species) duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6 | 
|  | Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries) Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108 | 
|  | Domain d1ywhe2: 1ywh E:1-79 [145932] automated match to d1ywha2 complexed with nag, ndg, so4 | 
PDB Entry: 1ywh (more details), 2.7 Å
SCOPe Domain Sequences for d1ywhe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywhe2 g.7.1.3 (E:1-79) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnqg
Timeline for d1ywhe2: