Lineage for d1u88a1 (1u88 A:82-208)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915620Protein Class alpha GST [81349] (8 species)
  7. 915717Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries)
    Uniprot P08515
  8. 915731Domain d1u88a1: 1u88 A:82-208 [145780]
    Other proteins in same PDB: d1u88a2, d1u88b2
    automatically matched to d2fhea1
    complexed with gty; mutant

Details for d1u88a1

PDB Entry: 1u88 (more details), 3.5 Å

PDB Description: crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with s-octyl glutathione
PDB Compounds: (A:) Glutathione S-Transferase 26 kDa

SCOPe Domain Sequences for d1u88a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u88a1 a.45.1.1 (A:82-208) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqa

SCOPe Domain Coordinates for d1u88a1:

Click to download the PDB-style file with coordinates for d1u88a1.
(The format of our PDB-style files is described here.)

Timeline for d1u88a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u88a2