Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries) Uniprot P08515 |
Domain d1u88a1: 1u88 A:82-208 [145780] Other proteins in same PDB: d1u88a2, d1u88b2 automatically matched to d2fhea1 complexed with gty; mutant |
PDB Entry: 1u88 (more details), 3.5 Å
SCOPe Domain Sequences for d1u88a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u88a1 a.45.1.1 (A:82-208) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw plqgwqa
Timeline for d1u88a1: