Lineage for d2nxnb1 (2nxn B:70-139)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695516Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 2695525Domain d2nxnb1: 2nxn B:70-139 [145699]
    Other proteins in same PDB: d2nxna1, d2nxnb2
    automatically matched to 2HGJ L:70-139

Details for d2nxnb1

PDB Entry: 2nxn (more details), 2.4 Å

PDB Description: t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2nxnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxnb1 a.4.7.1 (B:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiag
sarsmgvevv

SCOPe Domain Coordinates for d2nxnb1:

Click to download the PDB-style file with coordinates for d2nxnb1.
(The format of our PDB-style files is described here.)

Timeline for d2nxnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nxnb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2nxna1