Lineage for d2nxna1 (2nxn A:1-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130247Family c.66.1.39: Ribosomal protein L11 methyltransferase PrmA [102578] (1 protein)
    contains additional N-terminal ferredoxin-like domain
    automatically mapped to Pfam PF06325
  6. 2130248Protein PrmA-like protein TTHA0656 (TT0836) [102579] (1 species)
  7. 2130249Species Thermus thermophilus [TaxId:274] [102580] (8 PDB entries)
  8. 2130258Domain d2nxna1: 2nxn A:1-254 [138744]
    Other proteins in same PDB: d2nxnb1, d2nxnb2
    automatically matched to d1ufka_

Details for d2nxna1

PDB Entry: 2nxn (more details), 2.4 Å

PDB Description: t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11
PDB Compounds: (A:) Ribosomal protein L11 methyltransferase

SCOPe Domain Sequences for d2nxna1:

Sequence, based on SEQRES records: (download)

>d2nxna1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}
mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
eaaegewvllaygr

Sequence, based on observed residues (ATOM records): (download)

>d2nxna1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}
mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdwlea
wrrdlkpalappfvvlapwhtwegaeiplviepgmatghhettrlalkalarhlrpgdkv
ldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgp
fdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleeaae
gewvllaygr

SCOPe Domain Coordinates for d2nxna1:

Click to download the PDB-style file with coordinates for d2nxna1.
(The format of our PDB-style files is described here.)

Timeline for d2nxna1: