Lineage for d2jbgb1 (2jbg B:448-576)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155547Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2155548Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2155549Family d.4.1.1: HNH-motif [54061] (3 protein domains)
  6. 2155550Protein DNase domain of colicin E7 [54062] (1 species)
  7. 2155551Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)
  8. 2155561Domain d2jbgb1: 2jbg B:448-576 [145681]
    Other proteins in same PDB: d2jbga_, d2jbgc_
    protein/DNA complex; complexed with so4, zn; mutant

Details for d2jbgb1

PDB Entry: 2jbg (more details), 2.2 Å

PDB Description: crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7
PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d2jbgb1:

Sequence, based on SEQRES records: (download)

>d2jbgb1 d.4.1.1 (B:448-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdaisvvtpk
rhidihrgk

Sequence, based on observed residues (ATOM records): (download)

>d2jbgb1 d.4.1.1 (B:448-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhevydmdaisvvtpkrhidihrg
k

SCOPe Domain Coordinates for d2jbgb1:

Click to download the PDB-style file with coordinates for d2jbgb1.
(The format of our PDB-style files is described here.)

Timeline for d2jbgb1: