PDB entry 2jbg

View 2jbg on RCSB PDB site
Description: crystal structure of the mutant N560A of the nuclease domain of ColE7 in complex with Im7
Class: hydrolase/inhibitor
Keywords: hydrolase/inhibitor, hydrolase-inhibitor complex, zinc, toxin, plasmid, nuclease, hydrolase, antibiotic, h-n-h motif, bacteriocin, endonuclease, metal-binding, antimicrobial, DNA hydrolysis, bacteriocin immunity, his metal finger motif
Deposited on 2006-12-07, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin-e7 immunity protein
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jbga_
  • Chain 'B':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-130)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d2jbgb1
  • Chain 'C':
    Compound: colicin-e7 immunity protein
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jbgc_
  • Chain 'D':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-130)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d2jbgd_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jbgA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jbgB (B:)
    krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
    dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdaisvvt
    pkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jbgB (B:)
    nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
    elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhevydmdaisvvtpkrhidihrg
    k
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jbgC (C:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jbgD (D:)
    krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
    dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdaisvvt
    pkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jbgD (D:)
    nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
    elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhevydmdaisvvtpkrhidihrg
    k