SCOP 1.75: Domain d2jbgb1: 2jbg B:448-576

Lineage for d2jbgb1 (2jbg B:448-576)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (2 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (8 PDB entries)

8. Domain d2jbgb1: 2jbg B:448-576 [145681]
   Other proteins in same PDB: d2jbga1, d2jbgc1
   complexed with so4, zn; mutant

Details for d2jbgb1

PDB Entry: 2jbg, 2.2 Å

PDB Description: crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7

PDB Compounds: (B:) colicin e7

SCOP Domain Sequences for d2jbgb1:

Sequence, based on SEQRES records:

>d2jbgb1 d.4.1.1 (B:448-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdaisvvtpk
rhidihrgk

Sequence, based on observed residues (ATOM records):

>d2jbgb1 d.4.1.1 (B:448-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp
elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhevydmdaisvvtpkrhidihrg
k

Timeline for d2jbgb1:

• d2jbgb1 is new in SCOP 1.75
  
• d2jbgb1 appears in SCOPe 2.01
  
• d2jbgb1 appears in the current release, SCOPe 2.08