![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (3 proteins) |
![]() | Protein DNase domain of colicin E7 [54062] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54063] (10 PDB entries) |
![]() | Domain d2jbgd_: 2jbg D: [145682] Other proteins in same PDB: d2jbga_, d2jbgc_ automated match to d1mz8b_ protein/DNA complex; complexed with so4, zn; mutant |
PDB Entry: 2jbg (more details), 2.2 Å
SCOPe Domain Sequences for d2jbgd_:
Sequence, based on SEQRES records: (download)
>d2jbgd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdaisvvtpk rhidihrgk
>d2jbgd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} nkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdp elskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhevydmdaisvvtpkrhidihrg k
Timeline for d2jbgd_: