SCOPe 2.08: Domain d2jazb1: 2jaz B:450-576

Lineage for d2jazb1 (2jaz B:450-576)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)

8. Domain d2jazb1: 2jaz B:450-576 [145679]
   Other proteins in same PDB: d2jaza_, d2jazc_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2jazb1

PDB Entry: 2jaz, 2.03 Å

PDB Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7

PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d2jazb1:

Sequence, based on SEQRES records:

>d2jazb1 d.4.1.1 (B:450-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmddisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records):

>d2jazb1 d.4.1.1 (B:450-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekvydmddisvvtpkrhidihrgk

Timeline for d2jazb1:

• d2jazb1 first appeared in SCOP 1.75
  
• d2jazb1 appears in SCOPe 2.07