SCOPe 2.08: Domain d2jaza_: 2jaz A:

Lineage for d2jaza_ (2jaz A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d2jaza_: 2jaz A: [138244]
   Other proteins in same PDB: d2jazb1, d2jazd_
   automated match to d1mz8a_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2jaza_

PDB Entry: 2jaz, 2.03 Å

PDB Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7

PDB Compounds: (A:) colicin e7 immunity protein

SCOPe Domain Sequences for d2jaza_:

Sequence; same for both SEQRES and ATOM records:

>d2jaza_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg

Timeline for d2jaza_:

• d2jaza_ first appeared in SCOP 1.73, called d2jaza1
  
• d2jaza_ appears in SCOPe 2.07