Lineage for d2jazb1 (2jaz B:450-576)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535017Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2535018Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2535019Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2535020Protein DNase domain of colicin E7 [54062] (1 species)
  7. 2535021Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)
  8. 2535025Domain d2jazb1: 2jaz B:450-576 [145679]
    Other proteins in same PDB: d2jaza_, d2jazc_
    protein/DNA complex; complexed with po4, zn; mutant

Details for d2jazb1

PDB Entry: 2jaz (more details), 2.03 Å

PDB Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d2jazb1:

Sequence, based on SEQRES records: (download)

>d2jazb1 d.4.1.1 (B:450-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmddisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records): (download)

>d2jazb1 d.4.1.1 (B:450-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekvydmddisvvtpkrhidihrgk

SCOPe Domain Coordinates for d2jazb1:

Click to download the PDB-style file with coordinates for d2jazb1.
(The format of our PDB-style files is described here.)

Timeline for d2jazb1: